8E73E

Vigna radiata supercomplex i+iii2 (full bridge)
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
74
structure length
74
Chain Sequence
EIPATVAAVKNPSSKIIYDEHNHERFPPGDPSKRAFAYFVLTGGRFVYASLIRLLVLKFVLSMSASKDVLALAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Plant-specific features of respiratory supercomplex I + III 2 from Vigna radiata.
pubmed doi rcsb
molecule keywords MPP-beta
molecule tags Electron transport
total genus 17
structure length 74
sequence length 74
chains with identical sequence Q
ec nomenclature ec 7.1.1.8: quinol--cytochrome-c reductase.
pdb deposition date 2022-08-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...