8E8SH

9h2 fab-poliovirus 2 complex
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
126
structure length
126
Chain Sequence
LVQSGAELKKPGASVKFSCQASGFTFTTYDIHWVRQAPGQGLEWMGMISPSRDSTIYAQKFQGRVTMTSDTSTSTVYMELTSLRSEDTALYYCATASRPSAWVFRSLYTYYYMDVWGTGTTVTVSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/immune system
molecule keywords Capsid protein VP1
publication title High resolution cryo EM structures show a human monoclonal antibody binds into the canyon to neutralize all three serotypes of poliovirus
rcsb
source organism Homo sapiens
total genus 23
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2022-08-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...