8E9DA

Crystal structure of e. coli aspartate aminotransferase mutant aifs bound to maleic acid at 100 k
Total Genus 143
50100150200250300350020406080100120140
Genus TraceResidueGenus

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
399
structure length
399
Chain Sequence
HVGTFENITAAPADPILGLADLFRADERPGKINLGIGAYIDETGKFPVLTSVKKAEQYLLENETTKSYLGIDGIPEFGRCTQELLFGKGSALINDKRARTAQTPGGTGALRVAADFLAKNTSVKRVWVSNPSWPNHKSVFNSAGLEVREYAYYDAENHTLDFDALINSLNEAQAGDVVLFHGCCHNPTGIDPTLEQWQTLAQLSVEKGWLPLFDFAYQGFARGLEEDAEGLRAFAAMHKELIVASSYSKNFGLYNERVGACTLVAADSETVDRAFSQMKAAIRANYSNPPAHGASVVATILSNDALRAIWEQELTDMRQRIQRMRQLFVNTLQEKGANRDFSFIIKQNGMFSFSGLTKEQVLRLREEFGVYAVASGRVNVAGMTPDNMAPLCEAIVAVL
50100150200250300350300200100
020406080100120140Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTI1 (0-3)TI2 (2-5)AH1 (15-22)TII1 (25-28)TI9 (370-373)3H3 (377-379)TI3 (38-41)TI10 (381-384)AH11 (288-299)AH2 (47-59)TI4 (67-70)AH3 (72-83)TII2 (84-87)TIV8 (216-219)AH4 (88-92)O1 (100-102)S10 (256-261)AH5 (102-117)S3 (122-126)S7 (174-178)S5 (150-151)TIV3 (126-129)TIV5 (182-185)AH6 (131-140)TIV7 (212-215)TI6 (166-169)S8 (207-212)TII3 (170-173)TIV6 (183-186)S11 (348-350)AH8 (191-204)S9 (238-243)TII4 (214-217)TIV9 (217-220)TI8 (246-249)AH12 (301-332)AH9 (221-233)TVIII1 (235-238)TI7 (245-248)TIV10 (244-247)3H1 (251-253)3H2 (339-343)S13 (374-376)AH14 (384-395)S2 (95-100)S4 (143-147)AH7 (159-166)TIV4 (151-154)S6 (156-157)AH13 (355-365)S12 (367-368)TIV1 (11-14)AH10 (265-281)TIV11 (281-284)Updating...
connected with : NaN
molecule tags Transferase
source organism Escherichia coli
publication title Computational remodeling of an enzyme conformational landscape for altered substrate selectivity
doi rcsb
molecule keywords Aspartate aminotransferase
total genus 143
structure length 399
sequence length 399
chains with identical sequence B
ec nomenclature ec 2.6.1.1: aspartate transaminase.
pdb deposition date 2022-08-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...