8EEMA

C. ammoniagenes monoamine oxidase (mao) bound to norepinephrine
Total Genus 157
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
157
sequence length
440
structure length
440
Chain Sequence
KVVIIGAGFAGLVAARELQTAGIEYEILEAKDRIGGRAWTEERMGRPLELGATWVHWFQAHTWTEIMRYGQRTEITASPSGNDAHWVTDGKVVKGTEDDLDEKLTAAMGVTYEGSEEYFPNPHDPLWVLSDDFDGPAEVRERFLSDDQTNAIDLVKEAGFDQETIDLVDAFWCAGYIGDPYTGSALMAKQWGALSDNRYRVMEDITLKWKLNNGMRSLYDGIAGDLNTDIRLNTPVAKVEHHDNGATVTTESGEVIEASAVICTVPVGALSNIEFSPALPDAVQSVIDDKWNSQGAKIWIKIKGHHRFLGYAPKPAKMSVVRSEYFMDDDTTILVGFGYDNTNIDLNSIEDAQAVINQWRDDLEVVDTTGHNWVADKWAGQAWGTLRKGQFTQGWSLFDDIDSQLFFAGSDYAYGWRGVCVDGALEKGMTTARQVINSMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Flavoprotein
molecule keywords Amine oxidase
publication title Structural Insights into the Substrate Range of a Bacterial Monoamine Oxidase.
pubmed doi rcsb
source organism Corynebacterium ammoniagenes
total genus 157
structure length 440
sequence length 440
chains with identical sequence B
ec nomenclature
pdb deposition date 2022-09-07
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...