8EHBA

Structure of tannerella forsythia selenomethionine-derivatized potempin d mutant i53m
Total Genus 24

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
102
structure length
102
Chain Sequence
ESHASCSCECVEEKIPIVTLKNENAHFRYMKRRNDFALEIENKELVRGLYLIPRGCDIPKKYKEDGLPVIISGEVFDCSEYIKPWIKRDPVYFIKLSTIKKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
3H1 (66-68)S1 (25-26)S2 (37-51)TIV4 (63-66)EMPTYS5 (90-101)TIV3 (54-57)S3 (60-63)S4 (74-76)TII1 (76-79)TII2 (87-90)3H2 (83-85)O2 (85-87)TI'1 (69-72)TIV1 (33-36)Updating...
connected with : NaN
molecule tags Hydrolase inhibitor
source organism Tannerella forsythia (strain atcc 43037 / jcm 10827 / ccug 21028 a / kctc 5666 / fdc 338)
publication title A unique network of attack, defence and competence on the outer membrane of the periodontitis pathogen Tannerella forsythia.
pubmed doi rcsb
molecule keywords Putative lipoprotein
total genus 24
structure length 102
sequence length 102
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2022-09-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.