8EKTA

Cyp51 from acanthamoeba castellanii in complex with the tetrazole-based ind inhibitor vt-1161(vt1)
Total Genus 148
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
148
sequence length
413
structure length
413
Chain Sequence
KYGDIFTMKVFGQRLTFLVGPDAHVPFFSQGDAELSQDEPYQFSVPIFGPNVVYGADLAHRNQQLKFIAASLSTKALQSYVPLIVKEAEDFFAKWDKSGTVDIRDALAELIILTASRCLMGKEIRENLFTEVAKLYQTLDEGLLPISVFFPYLPIPAHKRRDEARLAMVRMFKKIIDERRANPEVKHNDCLQVFMDARYRGEEQALNDEEITGLMIALLFAGQHTSSVTGSWTGLLLFEANNKKKFLPGVLEEQEEIRKEFGDELTMEALNKMDKLHRCVKEALRMYPPLLFVMRKVIKPFSYKDYYVPEGDTVFVSPALSMRVEEVFPNADQYNPERFVEEDKQAQKYRFVGFGAGRHGCMGENFAYLQIKTIWSVLLRNFDIELVGELPKPDYTAMVVGPAHPCLLRYTRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title CYP51 from Acanthamoeba castellanii in complex with the tetrazole-based inhibitor VT-1161
rcsb
molecule keywords sterol 14a-demethylase
molecule tags Oxidoreductase/inhibitor
source organism Acanthamoeba castellanii
total genus 148
structure length 413
sequence length 413
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2022-09-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...