8ENIA

Crystal structure of staphylococcus aureus biotin protein ligase in complex with inhibitor
Total Genus 111

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
111
sequence length
322
structure length
321
Chain Sequence
SKYSQDVLQLLYKNKPNYISGQSIAESLNISRTAVKKVIDQLKLEGCKIDSVNHKGHLLQQLPDIWYQGIIDQYTKSSALFDFSEVYDSIDSTQLAAKKSLVGNQSSFFILSDEQTKGRGRFNRHWSSKGQGLWMSVVLRPNVAFSMISKFNLFIALGIRDAIQHFSQDEVKVKWPNDIYIDNGKVCGFLTEMVANNDGIEAIICGIGINLTQQLENFDESIRHRATSIQLHDKNKLDRYQFLERLLQEIEKRYNQFLTLPFSEIREEYIAASNIWNRTLLFTENDKQFKGQAIDLDYDGYLIVRDEAGESHRLISADIDF
5010015020025030030025020015010050
020406080100Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
AH1 (4-15)TVIa1 (15-18)S1 (49-53)AH3 (33-46)EMPTYTIV2 (79-82)S3 (84-91)AH5 (94-102)TIV3 (116-119)S9 (201-212)TII2 (102-105)S4 (109-116)TIV4 (121-124)O1 (143-145)S5 (134-141)TI1 (198-201)AH6 (150-167)TI4 (299-302)S6 (173-176)S8 (186-198)AH7 (241-260)S7 (180-183)TIV9 (316-319)TIV6 (182-185)TVIa2 (176-179)TIV7 (212-215)3H3 (225-227)3H4 (231-234)AH8 (267-274)TIV8 (277-280)S10 (280-286)S14 (320-322)TII'1 (286-289)S11 (289-298)S13 (313-316)S2 (57-62)TII1 (53-56)AH4 (69-78)3H1 (147-149)3H2 (217-219)TI2 (221-224)3H5 (264-266)S12 (304-308)TI5 (308-311)AH2 (22-29)TII3 (130-133)Updating...
connected with : NaN
molecule tags Ligase/ligase inhibitor
source organism Staphylococcus aureus subsp. aureus mu50
publication title Halogenation of Biotin Protein Ligase Inhibitors Improves Whole Cell Activity against Staphylococcus aureus.
pubmed doi rcsb
molecule keywords Bifunctional ligase/repressor BirA
total genus 111
structure length 321
sequence length 322
ec nomenclature ec 6.3.4.15: biotin--[biotin carboxyl-carrier protein] ligase.
pdb deposition date 2022-09-30
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.