8EO9A

The solution structure of abxf, an enzyme catalyzing the formation of chiral spiroketal of an antibiotics, (-)-abx
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
245
structure length
245
Chain Sequence
GSHMSHDAVRPAPGEPTWVDLLTPDRGAALQFYSALFGWEFSTTSDGTSPYTMCRLRGREVCSIGDLGENPGPALGGWSSYLSVDDADAAAAAVPELGGAVLLGPIDILAQGRMLLAGDPSGHRVGLWQAKEHTGSGPDDGIGAYTRSELLTGASATDGAFYRGLFGADFATESGTDGGGRRAAIRQVGPAAPSGWYPCFRAQESAVPAAVMLGASVLLRYDCPDGPAVVVSAPGGEVFTLLLTD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The solution structure of abxF, an enzyme catalyzing the formation of chiral spiroketal of an antibiotics, (-)-ABX.
rcsb
molecule keywords Glyoxalase
molecule tags Biosynthetic protein
source organism Streptomyces sp.
total genus 28
structure length 245
sequence length 245
ec nomenclature
pdb deposition date 2022-10-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...