8EQMD

Structure of a dimeric photosystem ii complex acclimated to far-red light
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
338
structure length
338
Chain Sequence
WIKQLDDWLKRDRFVFIGWSGLLLFPCSFLAIGAWFTGTTFVTSWYTHGLVSSYLEGCNFLTVAVSTPAESMGHSLLLLWGPEASGDFVRWCQIGGLWTFTALHGVFGLIGFMLRQIEIARLVGIRPYNAIAFSAPIAVYCATFLIYPLGQSSWFFGPGFGVSAIFRFLLFFQGFHNYTLNPFHMMGVTGVLGGALLCAIHGATVQNTLFRDNQSKNTFKGFSTDQGEETYSMVTANRFWSQIFGIAFSNKRWLHFFMLFVPVTGLWMSAIGMAGLAFNLRAYDFVSQEIRAAEDPEFETFYTKNILLNEGLRAWLSEMDQPAKKFVFPDEVLPRGFS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of a dimeric photosystem II complex from a cyanobacterium acclimated to far-red light.
pubmed doi rcsb
molecule keywords Photosystem II protein D1
molecule tags Photosynthesis
total genus 116
structure length 338
sequence length 338
chains with identical sequence d
ec nomenclature ec 1.10.3.9: photosystem II.
pdb deposition date 2022-10-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...