8ETHD

Ytm1 associated 60s nascent ribosome state 1b
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
445
structure length
422
Chain Sequence
KFSDLQLSENIQKAIKEMGFETMTEIQKRSIPPLLAGRDVLGAAKTGSGKTLAFLIPTIEMLYALKFKPRNGTGVIIISPTRELALQIFGVAKELLKYHHQTFGIVIGGANRRAEADKLVKGVNLLVATPGRLLDHLQNTKGFVFRNLRSLVIDEADRILEIGFEDEMRQIMKILPSENRQTLLFSATQTTKVEDLARISLKPGPLYVEQGYVVVDSDKRFLLLFSFLKRNLKKKVIVFMSSCASVKYMAELLNYIDLPVLDLHGKQKQQRRTNTFFEFCNAEKGILLCTNVAARGLDIPAVDWIVQYDPPDDPRDYIHRVGGKSLMFLAPSELGFLRYLKTAKVSLNEFEFPANKVANVQSQLEKLVSKNYYLQQSAKDGYRSYLQAYASYSLKSIFDINKLDLAKVAKSFGFAHPPNVNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Chromatin localization of nucleophosmin organizes ribosome biogenesis.
pubmed doi rcsb
molecule tags Ribosome
molecule keywords RNA (1263-MER)
total genus 123
structure length 422
sequence length 445
ec nomenclature ec 3.6.4.13: RNA helicase.
pdb deposition date 2022-10-17
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...