The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
33
|
sequence length |
115
|
structure length |
115
|
Chain Sequence |
NASGSAILNVAKSRIGKQYMSGGTGPDLFDCSGLVLYSHNQCGVYGVPRVAKDQARGGKAGSGAAGDVVYFGNPAHHVGICCGDGSMVHAPRPGKTVCILKIAYMKESYGYRRYY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Hydrolase/inhibitor
|
| molecule keywords |
Clan CA, family C40, NlpC/P60 superfamily cysteine peptidase
|
| publication title |
NlpC/P60 peptidoglycan hydrolases of Trichomonas vaginalis have complementary activities that empower the protozoan to control host-protective lactobacilli.
pubmed doi rcsb |
| source organism |
Trichomonas vaginalis
|
| total genus |
33
|
| structure length |
115
|
| sequence length |
115
|
| ec nomenclature | |
| pdb deposition date | 2022-10-19 |
Image from the rcsb pdb (www.rcsb.org)
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
