8F09A

Crystal structure of a trimethoprim-resistant dihydrofolate reductase (dhfr) enzyme from an uncultured soil bacterium
Total Genus 42
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
42
sequence length
167
structure length
167
Chain Sequence
GMIISLIAALTENRVIGKSNDLPWHLPDDMKYFMQTTLGHHVIMGRKNYESIPAKFRPLANRTNIVVTRQEEYDAAGCIVVNSIPAGIDIAIDNREAEVFIIGGAEIYTQSLAFANRLYLTEIQTSLEGDAFFPMFNKHEWNELSRKHHPLDEKHRYSFDFVIYEKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Dihydrofolate reductase
publication title Crystal structure of a trimethoprim-resistant dihydrofolate reductase (DHFR) enzyme from an uncultured soil bacterium
rcsb
source organism Uncultured bacterium
total genus 42
structure length 167
sequence length 167
chains with identical sequence B
ec nomenclature ec 1.5.1.3: dihydrofolate reductase.
pdb deposition date 2022-11-02
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...