8F5GA

Nusg-rna complex
Total Genus 32

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
169
structure length
169
Chain Sequence
GTMKKWYVIFTRSGYENKVRDIIENCFKEEVKLLIPKRKIIERVKGQPVEKIKLLFPGYVFVNAEMSDDLYYKISEVLKRGIFLKEGKRPAFVKEEEMKIILSLTKNSDLIDLSKGIMEGERVKIIEGPLKGYEGLIKKIDKRKKRAKVIFSIAGELKSVDLAIEVMEN

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYS1 (3-8)TII4 (83-86)TII1 (10-13)S5 (57-62)AH1 (13-25)TII3 (79-82)TI1 (25-28)S2 (30-32)S3 (35-42)TIV5 (103-106)S12 (154-163)S4 (45-52)TIV1 (41-44)TVIII1 (52-55)TIV6 (150-153)TIV2 (76-79)TI3 (92-95)TIV4 (93-97)AH3 (97-103)TI4 (126-129)S8 (112-117)TII'1 (117-120)S9 (120-125)TII5 (128-131)3H1 (132-134)S10 (135-139)S11 (144-151)S6 (89-91)AH2 (66-76)3H2 (140-142)S7 (108-109)Updating...
connected with : NaN
molecule tags Rna binding protein/rna
source organism Thermoanaerobacter pseudethanolicus
publication title NusG-RNA complex
rcsb
molecule keywords RNA
total genus 32
structure length 169
sequence length 169
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2022-11-14
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.