8F6DB

Crystal structure of the cnnm2 cbs-pair domain in complex with arl15
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
164
structure length
142
Chain Sequence
YDLVCIGLTGSGKTSLLSKLCSTTGFSLNVKELGGADNIRKYWSRYYQGSQGVIFVLDSASSEDDLEAARNELHSALQHPQLCTLPFLILNHQDKPSVQEIKKYFELEPLARGKRWILQPCSLDDMDALKDSFSQLINLLEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural insights into ARL15 binding to CNNM magnesium transporters
rcsb
molecule tags Protein binding
source organism Homo sapiens
molecule keywords Metal transporter CNNM2
total genus 32
structure length 142
sequence length 164
chains with identical sequence D, F, H
ec nomenclature
pdb deposition date 2022-11-16
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...