8FAMA

Edited octopus bimaculoides synaptotagmin 1 c2a (i248v) at room temperature
Total Genus 19

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
130
structure length
130
Chain Sequence
HMVKLGKLQYSMDYDFQKGELTVNVIQAADLPGMDMSGTSDPYVKVYLMPDKKKKFETKVHRKTLNPVFNESFTFKNVPYADITGKTLIFAIYDFDRFSKHDQIGQVQVPMNSIDLGSVVEEWRDLTSPD

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Exocytosis
source organism Octopus bimaculoides
publication title Temperature-dependent RNA editing in octopus extensively recodes the neural proteome.
pubmed doi rcsb
molecule keywords Synaptotagmin
total genus 19
structure length 130
sequence length 130
chains with identical sequence B
ec nomenclature
pdb deposition date 2022-11-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.