8FE3B

Structure of dengue virus (denv2) in complex with prm12, an anti-prm monoclonal antibody
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
81
structure length
80
Chain Sequence
FHLTTRNGEPHMIVSRQEKGKSLLFKTEDGVNMCTLMADLGELCEDTITYKCPLLRQNEPEDIDCWCNSTSTWVTYGTCT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus/immune system
molecule keywords prM12 Fab Heavy Chain
publication title prM-reactive antibodies reveal a role for partially mature virions in dengue virus pathogenesis.
pubmed doi rcsb
source organism Mus musculus
total genus 9
structure length 80
sequence length 81
chains with identical sequence D, F
ec nomenclature ec 3.4.21.91: flavivirin.
pdb deposition date 2022-12-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...