8FMAA

Nodavirus rna replication proto-crown, detergent-solubliized c11 multimer
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
342
structure length
324
Chain Sequence
TRALQRAVIDKTKTPIETRFYPLDSLRTVTPKRVADNGHAVSGAVRDAARRLIDESITAVGGSKFEVNDLAQDFRNDTPADDAFIVGVDVDYYVTEPDVLLEHMRPVVLHTFNPKKVSGFDADSPFTIKNNLVEYKVSGGAAWVHPVWDWCEAGEFIASRVRTSWKEWFLQLPLRMIGLEKVGYHKIHHCRPWTDCPDRALVYTIPQYVIWRFNWIDTELHVRKLKRIEYQDETKPGWNRLEYVTDKNELLVSIGREGEHAQITIEKEKLDMLSGLSATQSVNARLIGMGHKDPQYTSMIVQYYTGKKVVSPISPTVYKPTMPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Nodavirus RNA replication crown architecture reveals proto-crown precursor and viral protein A conformational switching.
pubmed doi rcsb
molecule tags Viral protein
source organism Flock house virus
molecule keywords RNA-directed RNA polymerase
total genus 61
structure length 324
sequence length 342
chains with identical sequence B, C, D, E, F, G, H, I, J, K, L, M, N, O, P, Q, R, S, T, U, V
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2022-12-22
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...