8FMEA

Crystal structure of kemp eliminase hg3-shell in unbound state
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
300
structure length
300
Chain Sequence
QSIDQLIKARGKVYFGVATDQNRLTTGKNAAIIKADFGMVWPEESMQWDATEPSQGNFNFAGADYLVNWAQQNGKLIGGGMLVWHNQLPSWVSSITDKNTLINVMKNHITTLMTRYKGKIRAWDVVGEAFNEDGSLRQNVFLNVIGEDYIPIAFQTARAADPNAKLYIMDYNLDSASYPKTQAIVNRVKQWRAAGVPIDGIGSQMHLSAGQGAGVLQALPLLASAGTPEVSILMLDVAGASPTDYVNVVNACLNVQSCVGITVFGVADPDSWRASSTPLLFDGNFNPKPAYNAIVQNLQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of Kemp Eliminase 1A53-core in unbound state
rcsb
molecule tags Lyase
source organism Escherichia coli
molecule keywords Kemp Eliminase HG3-shell
total genus 113
structure length 300
sequence length 300
ec nomenclature
pdb deposition date 2022-12-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...