8FN41

Cryo-em structure of rnase-treated resc-a in trypanosomal rna editing
Total Genus 50

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
50
sequence length
352
structure length
319
Chain Sequence
GYGRWNQASVMQPETLLDLSQAGFYEGAANMVPKAFQLLVSDVAIRSRYSKVLQWCCLNMSNLQMDGELYVDFGKLLLKPSVMRKNRRIVSSYTLQQRLQVNHPYTWVPTLPESCLSKIQEQFLQPEGFAPIGKGVQLTYSGTIKRSKDQLHVDLDNKGKVLAVNSAWVNLQTAWCTHAKGPDVRLLLRSRPPIRRQDVELFASTPIIKLADDDVADVLPPEHGQLVYLSEDETRLFERVSDRGVTITVREVKRQPLIILRDEEEDPRVEYSLSAHIPANAAKATDVRAVGLTAFELAGRLAGLVAEDFVREYGCEAKL
5010015020025030030025020015010050
01020304050Genus Matrix

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTII3 (272-275)TIV12 (270-273)TVIII1 (310-313)TI6 (268-271)TIV1 (123-126)TIV3 (126-129)TIV14 (300-303)TIV2 (125-128)TIV8 (237-240)TI4 (233-236)TIV4 (133-136)TII1 (142-145)TIV5 (149-152)TI1 (144-147)TI2 (148-151)TIV6 (197-200)S1 (156-158)S6 (315-320)AH1 (201-217)S2 (221-232)TI5 (254-257)TIV10 (253-256)AH2 (246-253)TIV7 (234-237)TIV9 (238-241)TIV11 (269-272)TII2 (266-269)AH3 (277-282)S5 (304-310)S4 (291-299)Updating...
connected with : NaN
molecule tags Rna binding protein/rna
publication title Structural basis of gRNA stabilization and mRNA recognition in trypanosomal RNA editing.
pubmed doi rcsb
molecule keywords RNA-editing substrate-binding complex protein 1 (RESC1)
total genus 50
structure length 319
sequence length 352
ec nomenclature
pdb deposition date 2022-12-26
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.