8FNF7

Cryo-em structure of rnase-untreated resc-c in trypanosomal rna editing
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
70
structure length
70
Chain Sequence
TALDVAMRVNKLKRLHQTGGGPSGKKQVELDAWRDLNNLTEAQINSAEGKAVSLLLNSWAYFAKYWEKGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of gRNA stabilization and mRNA recognition in trypanosomal RNA editing.
pubmed doi rcsb
molecule keywords mRNA
molecule tags Rna binding protein/rna
total genus 22
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2022-12-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...