8FNK7

Cryo-em structure of rnase-untreated resc-b in trypanosomal rna editing
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
70
structure length
64
Chain Sequence
TALDVAMRVNKLKRLHQTKKQVELDAWRDLNNLTEAQINSAEGKAVSLLLNSWAYFAKYWEKGA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Rna binding protein/rna
molecule keywords mRNA
publication title Structural basis of gRNA stabilization and mRNA recognition in trypanosomal RNA editing.
pubmed doi rcsb
total genus 18
structure length 64
sequence length 70
ec nomenclature
pdb deposition date 2022-12-27
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...