8FP4A

Glua2 flip q isoform of ampa receptor in complex with gain-of-function tarp gamma-2, with 500mm nacl, 330um ctz, and 100mm glutamate (open-na610)
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
316
structure length
149
Chain Sequence
KPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Glutamate receptor 2
publication title The open gate of the AMPA receptor forms a Ca2+ binding site critical in regulating ion transport
doi rcsb
source organism Rattus norvegicus
total genus 57
structure length 149
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec ?:
pdb deposition date 2023-01-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...