8FQ5A

Glua2 flip q isoform of ampa receptor in complex with gain-of-function tarp gamma2, with 140mm nmdg, 330um ctz, and 100mm l-glutamate (open-na110)
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
316
structure length
149
Chain Sequence
KPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTSSESTNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKSRAEAKRMK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords Glutamate receptor 2
publication title Open gate of AMPA receptor is a Ca2+ binding site critical to ion transport
rcsb
source organism Rattus norvegicus
total genus 58
structure length 149
sequence length 316
chains with identical sequence B, C, D
ec nomenclature ec ?:
pdb deposition date 2023-01-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...