8G0ID

High affinity nanobodies against gfp
Total Genus 25

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
116
structure length
116
Chain Sequence
DVQLVESGGGLVQPGGSLRLSCAASGEIASIIAIGWYRQAPGKQRESVALITRSGMITYGDSAQGRFTISRDDAKNTVYLHMDDLVPEDTAVYYCNAKKVSFGDYWGQGTQVTVSG

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Immune system
source organism Aequorea victoria
publication title High Affinity nanobodies against GFP
rcsb
molecule keywords Green fluorescent protein
total genus 25
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2023-01-31
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.