8G32A

Pro-form of a cdcl short from e. anophelis
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
345
structure length
327
Chain Sequence
NSSKVLNPNVTLPANNLLYDEFFVSKESKLIEDSRNNKLTTTSSTLTSDQIVVTVPQKTFIGGVYNSTTLDNLDYTPISYPLDPITVSYSFPSDFIVDTIERPSLSSMRASVFKAMRAANFSGEQSLAFDYNIKQFSYYSELKIAFGSNVNIGKIFSIDISGSNNKIKRTTGVFAKFTQKNFTIDMDLPADGNIFKNNSDLALTNGKNPVYISSVTYGRLGIISIESNASYNEVNFALKAALTAGIVNGSLNIDSNSKKILEESDLSVYLVGGRGTDAVQVIKGFAGFSNFIVNGGQFTPEAPGVPIYFSASHASDNSVYYTTFTID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Pro-form of a CDCL short from E. anophelis
rcsb
molecule keywords Thiol-activated cytolysin family protein
molecule tags Toxin
source organism Elizabethkingia anophelis ag1
total genus 92
structure length 327
sequence length 345
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-02-06
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...