8G4MA

Vaccine-elicited human antibody 2c06 in complex with hiv-1 envelope trimer bg505 ds-sosip
Total Genus 35
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
35
sequence length
153
structure length
133
Chain Sequence
AVGIGAVFLGFLGAAGSTMGAASMTLTVQARNLLSGLTVWGIKQLQARVLAVERYLRDQQLLGIWGCSGKLICCTNVPWNSSWSNRNLSEIWDNMTWLQWDKEISNYTQIIYGLLEESQNQQEKNEQDLLALD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title HIV Neutralizing Antibodies Elicited in Humans by a Prefusion-Stabilized Envelope Trimer Form a Reproducible Class Targeting Fusion Peptide
rcsb
molecule tags Antiviral protein
source organism Human immunodeficiency virus 1
molecule keywords Envelope glycoprotein gp120
total genus 35
structure length 133
sequence length 153
chains with identical sequence B, F
ec nomenclature
pdb deposition date 2023-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...