8G4PA

Crystal structure of the peanut allergen ara h 2 bound by two neutralizing antibodies 13t1 and 13t5
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
226
structure length
222
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGGSMSSYYWGWIRQPAGRGLEWIGRIFTTGSTIYNASLNSRVSMSVDTSKNQFSLKLTSVTAADTALYFCVRDRRGRSHDSNWYWYFDLWGRGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Design of an Ara h 2 hypoallergen from conformational epitotes
rcsb
molecule keywords 13t1 Fab heavy chain
molecule tags Allergen
source organism Homo sapiens
total genus 43
structure length 222
sequence length 226
ec nomenclature
pdb deposition date 2023-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...