8G4ST

40s ribosomal subunit of the 80s giardia intestinalis assemblage a ribosome with emetine bound in v2 conformation with mrna and three trnas.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
137
structure length
137
Chain Sequence
SVTRVPADVFINSFAAHLKNRGIIKCPAFTDYVKTGVSRQYAPRDADWFYIKAASVIRHFYISGSHSIGVAGLARKYSSLQKGKTTPHHTKRASCKVIRSIVSQFLGQKLLIAGERGRHISPNGRKMVEDFAEGLQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The Giardia lamblia ribosome structure reveals divergence in several biological pathways and the mode of emetine function.
pubmed doi rcsb
molecule keywords 18S rRNA
molecule tags Ribosome
total genus 30
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2023-02-10
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...