8G5BH

Influenza a h3n2 x-31 hemagglutinin in complex with fl-1061
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
121
structure length
121
Chain Sequence
EVQLQESGAELVMPGASVKLSCKASGYTFTRYWMHWVKQRPGQGLEWIGEIDPSDSYTYYNQKFKGKSTLTVDKSSSTAYMQLNSLTSEDSAVYYCARNYGSSYGYFDVWGTGTTVTVGAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Fabs elicited by hyperglycosylated immunogen
rcsb
molecule tags Viral protein
source organism Influenza a virus
molecule keywords Hemagglutinin
total genus 31
structure length 121
sequence length 121
ec nomenclature
pdb deposition date 2023-02-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...