8G9MA

Acinetobacter_baumannii short-chain dehydrogenase
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
258
structure length
215
Chain Sequence
IMKLDLQNKIAVVSGSTSGIGLGIAKGLASAGATVVVVGRKQAGVDEAIAHIRQSVPEASLRGVDADLTTEQGAAALFAAEPKADILVNNLGIFNDEDFFSVPDEEWMRFYQVNVLSGVRLARHYAPSMVEQGWGRIIFISSESGVAIPGDMINYGVTKSANLAVSHGLAKRLAGTGVTVNAVLPGEVDEVANMVVYIASPLSSATSGAALRVDG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Acinetobacter_baumannii short-chain dehydrogenase
rcsb
molecule keywords Oxidoreductase, short chain dehydrogenase/reductase family
molecule tags Oxidoreductase
source organism Acinetobacter baumannii
total genus 71
structure length 215
sequence length 258
ec nomenclature ec 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
pdb deposition date 2023-02-21
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...