8GDHA

Solution structure of the neutrophil serine protease inhibitor, eaph1
Total Genus 18

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
114
structure length
114
Chain Sequence
GSTDSNNGYKELTMDGKHTVPYTISVDGITALHRTYFVFPENKKVLYQEIDSKVKNELASQRGVTTEKINNAQTATYTLTLNDGNKKVVNLKKNDDAKNSIDPSTIKQIQIVVK

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV2 (12-15)TII1 (14-17)AH1 (47-62)S1 (18-26)TIV4 (31-34)S2 (29-30)S8 (106-113)TIV3 (25-28)S4 (45-46)S7 (100-101)TI3 (96-99)S5 (75-81)TIV6 (90-93)TI1 (81-84)3H1 (103-105)S6 (86-90)TI2 (94-97)S3 (35-39)AH2 (66-71)Updating...
connected with : NaN
molecule tags Immune system/inhibitor
source organism Staphylococcus aureus
publication title Simultaneous inhibition of two neutrophil serine proteases by the S. aureus innate immune evasion protein EapH2.
pubmed doi rcsb
molecule keywords Cell surface protein map-w
total genus 18
structure length 114
sequence length 114
ec nomenclature
pdb deposition date 2023-03-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.