8GI0F

Structure of trypanosoma docking complex
Total Genus 18

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
58
structure length
58
Chain Sequence
EKRKRVSSAVQFLHDSRVKITPAANKIQFLKSKGLTTEEVCEAFEKAGQTIPLDEIKK

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
source organism Trypanosoma cruzi
publication title Structure of Trypanosoma docking complex
rcsb
molecule keywords Peroxisomal membrane protein PEX14
total genus 18
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2023-03-13
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.