8GM3A

Vibrio harveyi holo hpha
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
218
structure length
218
Chain Sequence
GFDGAISDDSLRQVGESEVWVPFIHSKGNAGIGKTGGKRVDFEGLAGGIFDDERNGVHTSGSKHFQDNFYSFVQVANQDVWFGEWYEGKKDSEFNNRTVYYVGNDAGTTVPTSGKATYNITGINKFSGANKLSGTFNADFGAKTLDGSINNSNLTVSVDATINAATAAFNGTAQAVQNGTTTNGASQGHFFGANAAGLAGIATFTNNSDLDTAFGGEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Heme Acquisition by Slam-dependent Hemophores in Gram-negative Bacteria
rcsb
molecule keywords Hemophilin
molecule tags Metal transport
source organism Vibrio harveyi
total genus 54
structure length 218
sequence length 218
chains with identical sequence B
ec nomenclature ec ?:
pdb deposition date 2023-03-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...