8GM6A

Structure of apurinic/apyrimidinic dna lyase tk0353 from thermococcus kodakarensis (selenomethionine)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
169
structure length
169
Chain Sequence
MYSVKKSKSGYIFDKPRERIAFMFLKDGTYFMYHDGRILCYSLKPVDVSREELEEFERTGEPPELIKRVKAGKYPENCVVKELPPIDKGLAQLNPNRKCVIIFTGFQDTVIDYVECNGETLAVARLIDEPGKVCRFAGKGNYKVAAVKLKRNEPCLTREEFLKKVEECR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Thermococcus kodakarensis TK0353 is a novel AP lyase with a new fold
rcsb
molecule tags Lyase
source organism Thermococcus kodakarensis
molecule keywords TK0353
total genus 46
structure length 169
sequence length 169
chains with identical sequence B
ec nomenclature
pdb deposition date 2023-03-24
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...