8GMHD

Crystal structure of the ternary complex of tela-lxg, lapa3, and lapa4
Total Genus 27
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
78
structure length
78
Chain Sequence
GTDYSAWSELTSSVNTSVSGIVDLASLTFTTTTMTPFTSFNEDISSFNTAVAKLQSFTSTDVTHMNQAAENKVTDDSN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title LXG domain-containing complexes target toxins to the type VIIb secretion system
rcsb
molecule tags Protein binding
source organism Streptococcus intermedius b196
molecule keywords LXG domain-containing protein
total genus 27
structure length 78
sequence length 78
chains with identical sequence F
ec nomenclature ec ?:
pdb deposition date 2023-03-25
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...