8GQ4A

Histone acetyltransferase rtt109 mutant-n195a
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
359
structure length
316
Chain Sequence
MLPPDILQNGEFETIYFQTNPTYIKSPIHIPKSTIGKPDTVKIRHFFALLHQDLVVLGLEVFVYLQIYSDFVEKYVYVSKCDTVGLEKSTIKIGKVIGPVLQYIINYNGYKIKMKNLDEYRTLPKTQNLRLCVFTKPAKEYLFPNSAKNPYKALLNGQSLLRWWISIIDSITKGWNNHKLMIPGADKYATRKFIEKYSDWSEGHIFKKDGLAVQAIPLFPDDPGRFLELVIVECRYGKMTVSRFYQELAYRQEFLLGDCVSLIGCCKENLEVTYHDDLVSTVTISEYKEFMNLLKLVDFSDRVEVSNFVSNYRKSK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of Histone acetyltransferase Rtt109 mutant-N195A
rcsb
molecule keywords Histone acetyltransferase RTT109
molecule tags Transferase
source organism Candida albicans
total genus 92
structure length 316
sequence length 359
ec nomenclature ec 2.3.1.48: histone acetyltransferase.
pdb deposition date 2022-08-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...