8GYMV1

Cryo-em structure of tetrahymena thermophila respiratory mega-complex mc iv2+(i+iii2+ii)2
Total Genus 142
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
142
sequence length
442
structure length
442
Chain Sequence
RSYGNLKDQDRIFTNLYRDGDPFVKGALKRGDWHQTKEILSNGPEWIIDEIKKSGLRGRGGAGFLSGLKYSFMPKVNPDGRPSYLVINSDESEPGTCKDREILRNDPHKLVEGALVVGFSMRARAAYIYIRGEFWVEANILQQAIDEAYAKGFIGKNACGSGYDFDVYIHRGAGAYICGEETGLIESIEGKAGQPRVKPPFPANAGLYGCPTTVTNVETVAVCPTIMRRGASWFASFGRPNNAGTKLYCISGHVNNPCTVEEEMSIPLRELLEKHCGGVRGGWDNLLAVIPGGSSVPMMPKNVCDDVLMDFDALKAVGSGLGTAAVIVMDKSTDPIDAILRLSKFYKHESCGQCTPCREGTGWIVDVMERLLVGNADYAEIDMLQQVTQQIEMHTICALGDAAAWPVQGLIKNFREEIEDRIDSYHAKHPQLKKSRKSNPQI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of Tetrahymena thermophila respiratory megacomplexes on the tubular mitochondrial cristae.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords Tim10/DDP family zinc finger protein
total genus 142
structure length 442
sequence length 442
chains with identical sequence v1
ec nomenclature ec 7.1.1.2: NADH:ubiquinone reductase (H(+)-translocating).
pdb deposition date 2022-09-23
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...