8H1LA

Crystal structure of glucose-2-epimerase in complex with d-glucitol from runella slithyformis runsl_4512
Total Genus 179
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
179
sequence length
423
structure length
418
Chain Sequence
MTSEKIASLRQEIETYLNTGLLPFWITRTVDKENGGFLTHFDQFGNDSGEDEKSLIAQSRSVFTYSSAHRAGYGGGVLAEMARHGVDYLINNMWDNEHGGFYWMTNRKGEVTIDQKIVYGLSFCIYSLSEYTLATGDPRGREYAEKTFDLLQKYAVDTHYGGYFEMFNRDWTLKGPGAAGGDRKTLDVHMHLMEAYTTLYECTGQEIHRRKLLETIELLVNKVMHPEYGTGIPQFWADWSVAPQIKFDIVWGWDRFNPDAEDNTSYGHNSEFAWLLMHALDILGLPYDTYREQITKSYTHAVENGVDWEFGGVYVEGSHAGQVYDKEKEFWQQAEMLIGMLDAYRFLKDEKYLQAYENIHRFVFDKMINHSLGEWWPLMTREGVPIWKHMSHSWKINYHDVRSMIQSIVRLDKIAKGV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Isomerase
molecule keywords N-acylglucosamine 2-epimerase
publication title Structural insights into the substrate specificity and activity of a novel mannose 2-epimerase from Runella slithyformis.
pubmed doi rcsb
source organism Runella slithyformis
total genus 179
structure length 418
sequence length 423
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2022-10-03
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...