8H2FA

Crystal structure of dnaq domain in complex witn tmp of streptococcus thermophilus strain dgcc 7710
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
172
structure length
172
Chain Sequence
SKPYVVIDIETDGLDEKKNTIIEIGAVKFNGQQVEEFNALIKYEEKLPPTIFKLTGISKSLLDQEGRDLKEVLSEFLLFIGDLTLVGYNIHFDIQFINNKLNKFGLPLLINKTHDIMRYVKDEKLFLDNYQLQTALKSYGIEDSVPHRALKDARLIYHLSTKVNKFLARMKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title DnaQ mediates directional spacer acquisition in the CRISPR-Cas system by a time-dependent mechanism.
pubmed doi rcsb
molecule tags Lyase
source organism Streptococcus thermophilus dgcc 7710
molecule keywords DnaQ
total genus 53
structure length 172
sequence length 172
ec nomenclature
pdb deposition date 2022-10-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...