8H3JA

Crystal structure of pathogenesis-related protein hcpr10 from halostachys caspica in complex with trans-zeatin-riboside
Total Genus 41
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
41
sequence length
162
structure length
162
Chain Sequence
SMGVFTCTLADITSPVAPARLFQAFTIDNHNLMPKVVPQFVKSIDFVQGDSTAVGCVKQINFPADAPFTYVKNRVDEIDASKYYLKYTCIEGDAFPDTVEYAVYEDTFEQTETGSRCKMVAHYHLKGDSVMKEEDVAPAKEGIQKMFKAVEEHLIANPQLYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Halostachys caspica pathogenesis-related protein 10 acts as a cytokinin reservoir to regulate plant growth and development
doi rcsb
molecule keywords PR10
molecule tags Allergen
source organism Halostachys caspica
total genus 41
structure length 162
sequence length 162
ec nomenclature
pdb deposition date 2022-10-08
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...