8H67L

Type i-b cascade bound to a pam-containing dsdna target at 3.8 angstrom resolution.
Total Genus 120
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
120
sequence length
541
structure length
496
Chain Sequence
EILTLDFNLAELPSAQHRAGLAGLILMIRELKKWPWFKIRQKEKDVLLSIENLDQYGASIQLNLEGLIALFDLAYLSFTEERKSKFYDVITPQGGFLAGWDKSDGQIWLRIWRDMFWSIIKGVPATRNPFNNRCGLNLNAGDSFSKDVESVWKSLQNAEKTTGQSGAFYLGAMAVNAENVSTDDLIKWQFLLHFWAFVAQVYCPYILDKDGKRNFNGYVIVIPDIANLEDFCDILPDVLSNRNSKAFGFRPQESVIDVPEQGALELLNLIKQRIAKKAGSGLLSDLIVGVEVIHAEKQGNSIKLHSVSYLQPNEESVDDYNAIKNSYYCPWFRRQLLLNLVLASQSWLKRHPWYGFGDLLSRIPQRWLKENNSYFSHDARQLFTQKKTREYAEIVYKIAQGFVLSKLSSKHDLQWSKCKGNPKLEREYNDKKEKVVNEAFLAIRSRTEKQAFIDYFVSTLYPHEFVDFAQKLFQDTDEIRSLTLLALSSQYPIKRQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Cryo-EM structure of Synechocystis sp. PCC6714 Cascade bound to a PAM-containing dsDNA target at 3.8 angstrom resolution.
rcsb
molecule tags Rna binding protein
source organism Synechocystis sp. pcc 6714
molecule keywords CRISPR RNA
total genus 120
structure length 496
sequence length 541
ec nomenclature
pdb deposition date 2022-10-15
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...