8H6K6c

Cryo-em structure of human exon-defined spliceosome in the mature b state.
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
80
structure length
74
Chain Sequence
MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSWRMPECYIRGSTIKYLRIPDEIIDMVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Insights into Human Exon-defined Spliceosome Prior to Activation.
rcsb
molecule tags Splicing
molecule keywords pre-mRNA
total genus 13
structure length 74
sequence length 80
ec nomenclature
pdb deposition date 2022-10-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...