8H6PB

Complex structure of cdk2/cyclin e1 and a potent, selective macrocyclic inhibitor
Total Genus 90

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
90
sequence length
271
structure length
271
Chain Sequence
SPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTI6 (137-140)AH2 (142-159)TIV1 (135-138)TI1 (108-111)AH1 (113-126)TI2 (130-133)TI5 (134-137)TI4 (133-136)TI3 (132-135)AH4 (188-203)AH3 (163-178)TIV2 (260-263)3H1 (185-187)AH6 (223-237)TVIII1 (204-207)TI'1 (217-220)TVIII2 (219-222)TIV3 (264-267)AH7 (246-257)AH5 (210-217)TI'2 (237-240)Updating...
connected with : NaN
molecule tags Cell cycle
source organism Homo sapiens
publication title Accelerated Discovery of Macrocyclic CDK2 Inhibitor QR-6401 by Generative Models and Structure-Based Drug Design.
pubmed doi rcsb
molecule keywords Cyclin-dependent kinase 2
total genus 90
structure length 271
sequence length 271
ec nomenclature
pdb deposition date 2022-10-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.