8H6TB

Complex structure of cdk2/cyclin e1 and a potent, selective small molecule inhibitor
Total Genus 87
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
87
sequence length
272
structure length
272
Chain Sequence
GSPLPVLSWANREEVWKIMLNKEKTYLRDQHFLEQHPLLQPKMRAILLDWLMEVCEVYKLHRETFYLAQDFFDRYMATQENVVKTLLQLIGISSLFIAAKLEEIYPPKLHQFAYVTDGACSGDEILTMELMIMKALKWRLSPLTIVSWLNVYMQVAYLNDLHEVLLPQYPQQIFIQIAELLDLCVLDVDCLEFPYGILAASALYHFSSSELMQKVSGYQWCDIENCVKWMVPFAMVIRETGSSKLKHFRGVADEDAHNIQTHRDSLDLLDKA

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV4 (260-263)TI5 (137-140)TI1 (108-111)AH1 (113-124)TVIII1 (125-128)TIV2 (130-133)TI3 (133-136)TIV3 (135-138)TI2 (132-135)TI4 (134-137)AH2 (142-159)AH4 (185-203)AH3 (163-178)AH6 (223-237)TVIII2 (204-207)AH5 (210-217)TI'1 (217-220)TVIII3 (219-222)TI'2 (237-240)TIV5 (264-267)AH8 (272-286)TIV1 (124-127)AH7 (246-257)Updating...
connected with : NaN
molecule tags Cell cycle
source organism Homo sapiens
publication title Accelerated Discovery of Macrocyclic CDK2 Inhibitor QR-6401 by Generative Models and Structure-Based Drug Design.
pubmed doi rcsb
molecule keywords Cyclin-dependent kinase 2
total genus 87
structure length 272
sequence length 272
ec nomenclature
pdb deposition date 2022-10-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.