8HDLA

Crystal structure of asfv trans geranylgeranyl diphosphate synthase b318l
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
288
structure length
261
Chain Sequence
APRSVALFHGIHPLNPKNYKTFSKEFETILNNAIEDGDFKGQLTEPCSYALRGGKYIRPIILMEIVRACQLQHSFGAPIYPAEAALAVEYFHVASLIIDDMPDTVWARFGVAKAQMSALALTMQGFQNICRQIDWIKEHCPRFPDPNQLGALLCTFVSHSLNSAGEKTIPFFKIAFIMGWVLGTGTIEDIGMIERAAHCFGHAFQLADDIKDYAKIHGKQKTFDDVAQSLQECKKILHGKKIFTSIWNEIFQKVINVALGT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring AlphaFold2's Performance on Predicting Amino Acid Side-Chain Conformations and Its Utility in Crystal Structure Determination of B318L Protein.
pubmed doi rcsb
molecule tags Transferase
source organism African swine fever virus (strain badajoz 1971 vero-adapted)
molecule keywords Trans-prenyltransferase
total genus 86
structure length 261
sequence length 288
ec nomenclature ec 2.5.1.1: dimethylallyltranstransferase.
pdb deposition date 2022-11-04
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...