8HP2A

Ctpdc
Total Genus 164
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
164
sequence length
545
structure length
479
Chain Sequence
SEITLGRFFFERLHQLQVDTVFGLPGDFNLALLDKIYEVDGMRWAGNANELNAGYAADGYARVNPNGLAALVSTFGVGENAIAGSYSEHVGIINLVGVPSFKNISQTSAFISDPNTAASEIDRCIRDAYVYQRPVYIGLPSNLVDVKVPKSLLDKKIDLSLHPNEPESQAEVVETVEKFISEASNPVILVDACAIRHNCLKEVAELIAETQFPVFTTPMGKSSVDESNPRFGGVYVGSLSSPDVKEAVESADLVLSVGAMLRNVVEFHSDYTKIRQATFPGVQMKEALQVLLKTVKKSVNPKYVPAPVPPGNNDPVSQEYLWRKVSDWFQEGDVIISETGTSAFGIVQSKFPKNAIGISQVLWGSIGYATGATCGAAMAAQEIDPKKRVILFTGDGSLQLTVQEISTMCKWDCYNTYLYVLNNDGIQPWNNLQLLPLFNAKKYETKRISTVGELNDLFTNKEFAVPDRIRMVEIMLPVM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Lyase
molecule keywords Pyruvate decarboxylase
publication title Protein engineering of pyruvate decarboxylase to remove the rate-limiting bottleneck in the cascade pathway of tyrosol synthesis
rcsb
source organism Candida tropicalis
total genus 164
structure length 479
sequence length 545
chains with identical sequence B
ec nomenclature
pdb deposition date 2022-12-11
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...