8HPKH

Crystal structure of the bacterial oxalate transporter oxlt in an oxalate-bound occluded form
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
217
structure length
212
Chain Sequence
VQLQQSGPELVKPGASVKISCKASVNSFTGYFVNWVKQSHGKSLEWIGRVHPYNGNTFYNQKFKGRVTLTVDRSSTTAHMELLSLTSEDSAVYYCGRRDDYDTMDYWGQGTSVTVSSAKTTPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPESVTVTWNSSVHTFPALLQSGLYTMSSSVTVPSSTWPSQTVTCSVAHPASSTTVDKKLEPS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and mechanism of oxalate transporter OxlT in an oxalate-degrading bacterium in the gut microbiota.
pubmed doi rcsb
molecule keywords Oxalate:formate antiporter
molecule tags Transport protein/immune system
source organism Oxalobacter formigenes
total genus 31
structure length 212
sequence length 217
ec nomenclature
pdb deposition date 2022-12-12
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...