8HSBB

Cryo-em structure of cdng-e2 complex from serratia marcescens (ultraufoil)
Total Genus 17

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
159
structure length
159
Chain Sequence
VVIRHHCKPLTIAQQYRALKAGGPYERLRIIHHDRTLLWEGWLQPSLFSRRYKVAVRYSLGTPPICVVTEPDLFALAGTRAIPHLYPADKHIPGARLCLFLPRSQADDGLSEWRAQLKISDTLIPWASLWLFYFEQWLHTGHWEGGGKHPRPSEVKNER

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Antiviral protein
source organism Serratia marcescens
publication title Phage defence system CBASS is regulated by a prokaryotic E2 enzyme that imitates the ubiquitin pathway.
pubmed doi rcsb
molecule keywords CdnG
total genus 17
structure length 159
sequence length 159
ec nomenclature
pdb deposition date 2022-12-18
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.