8HW0A

The structure of akr6d1
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
329
structure length
329
Chain Sequence
MEYRRLGKSGLKVSEFSFGSWVTFGKQVDGGDAKTLMQAAYDAGINFFDNAEGYEQGNSEALMGAALKELGWDRDSYIVSSKVFWGGSKPTQKGLSRKHVTDACNAALKRLQVDYLDLYFCHRPDVDTPIEETVRAMDALITQGKILYWGTSEWNAQQLTEAYGVARAYGLTPPTMEQPQYNILERRKVEGDFLPLYELFGLGTTIWSPLASGILTGKYLEGIPNDSRLNLPGYEWLKERWSTPDGREKQAQVRELADLAKELGISLTHLSLLWCLANPHVSTVILGASRLSQLEDNLAALAHKDKVTPEVMARIDEIVGNKPAGPQRF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Toxin
molecule keywords NADPH-dependent aldo/keto reductase AKR6D1
publication title structure of AKR6D1
rcsb
source organism Devosia
total genus 131
structure length 329
sequence length 329
ec nomenclature
pdb deposition date 2022-12-28
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...