8HXYA

Cryo-em structure of the histone deacetylase complex rpd3s in complex with nucleosome
Total Genus 27

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
27
sequence length
102
structure length
101
Chain Sequence
GGVKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVALFEDTNLAAIHAKRVTIMPKDIQLARRIRGER

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
EMPTYTIV1 (42-45)AH2 (64-76)AH3 (87-114)TIV2 (79-82)TI1 (76-79)AH1 (45-56)Updating...
connected with : NaN
publication title Structure of histone deacetylase complex Rpd3S bound to nucleosome
doi rcsb
molecule keywords Histone H3
molecule tags Gene regulation
source organism Xenopus laevis
total genus 27
structure length 101
sequence length 102
chains with identical sequence E
ec nomenclature
pdb deposition date 2023-01-05
Image from the rcsb pdb (www.rcsb.org)
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...

Application loaded.